Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins) contains Pfam PF00929 |
Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) part of Klenow fragment, KF |
Species Thermus aquaticus [TaxId:271] [53121] (26 PDB entries) |
Domain d4dfpa1: 4dfp A:294-422 [219740] Other proteins in same PDB: d4dfpa2 automated match to d1jxea1 protein/DNA complex; complexed with 0l7, edo, fmt, mg |
PDB Entry: 4dfp (more details), 2 Å
SCOPe Domain Sequences for d4dfpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dfpa1 c.55.3.5 (A:294-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]} leeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkearglla kdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlf anlwgrleg
Timeline for d4dfpa1: