Lineage for d4dfpa1 (4dfp A:294-422)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1607175Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1607355Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 1607420Species Thermus aquaticus [TaxId:271] [53121] (24 PDB entries)
  8. 1607426Domain d4dfpa1: 4dfp A:294-422 [219740]
    Other proteins in same PDB: d4dfpa2
    automated match to d1jxea1
    protein/DNA complex; complexed with 0l7, edo, fmt, mg

Details for d4dfpa1

PDB Entry: 4dfp (more details), 2 Å

PDB Description: Crystal structure of the large fragment of DNA Polymerase I from Thermus aqauticus in a ternary complex with 7-(aminopentinyl)-7-deaza-dGTP
PDB Compounds: (A:) DNA polymerase I, thermostable

SCOPe Domain Sequences for d4dfpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dfpa1 c.55.3.5 (A:294-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
leeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkearglla
kdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlf
anlwgrleg

SCOPe Domain Coordinates for d4dfpa1:

Click to download the PDB-style file with coordinates for d4dfpa1.
(The format of our PDB-style files is described here.)

Timeline for d4dfpa1: