Lineage for d2ramb1 (2ram B:192-291)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765064Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2765111Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)
  7. 2765118Species Mouse (Mus musculus) [TaxId:10090] [49254] (13 PDB entries)
  8. 2765131Domain d2ramb1: 2ram B:192-291 [21938]
    Other proteins in same PDB: d2rama2, d2ramb2
    protein/DNA complex; complexed with dtv

Details for d2ramb1

PDB Entry: 2ram (more details), 2.4 Å

PDB Description: a novel dna recognition mode by nf-kb p65 homodimer
PDB Compounds: (B:) protein (transcription factor nf-kb p65)

SCOPe Domain Sequences for d2ramb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ramb1 b.1.18.1 (B:192-291) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}
aelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaiv
frtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd

SCOPe Domain Coordinates for d2ramb1:

Click to download the PDB-style file with coordinates for d2ramb1.
(The format of our PDB-style files is described here.)

Timeline for d2ramb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ramb2