Lineage for d1bfsa_ (1bfs A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765064Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2765078Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)
  7. 2765084Species Mouse (Mus musculus) [TaxId:10090] [49250] (15 PDB entries)
  8. 2765085Domain d1bfsa_: 1bfs A: [21927]

Details for d1bfsa_

PDB Entry: 1bfs (more details), 2.2 Å

PDB Description: structure of nf-kb p50 homodimer bound to a kb site
PDB Compounds: (A:) nuclear factor nf-kappa-b p50

SCOPe Domain Sequences for d1bfsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfsa_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

SCOPe Domain Coordinates for d1bfsa_:

Click to download the PDB-style file with coordinates for d1bfsa_.
(The format of our PDB-style files is described here.)

Timeline for d1bfsa_: