Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein) |
Protein Transglutaminase N-terminal domain [49235] (4 species) elaborated with many loop insertions in the common fold |
Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49236] (8 PDB entries) Coagulation factor XIII |
Domain d1f13a1: 1f13 A:5-190 [21877] Other proteins in same PDB: d1f13a2, d1f13a3, d1f13a4, d1f13b2, d1f13b3, d1f13b4 |
PDB Entry: 1f13 (more details), 2.1 Å
SCOPe Domain Sequences for d1f13a1:
Sequence, based on SEQRES records: (download)
>d1f13a1 b.1.18.9 (A:5-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]} rtafggrravppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdh htdkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivse lqsgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilf npwced
>d1f13a1 b.1.18.9 (A:5-190) Transglutaminase N-terminal domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]} rtafggrravppnnsnaaeddlptvelqgvvpvnlqeflnvtsvhlfkerwdtnkvdhht dkyennklivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselq sgkwgakivmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnp wced
Timeline for d1f13a1:
View in 3D Domains from other chains: (mouse over for more information) d1f13b1, d1f13b2, d1f13b3, d1f13b4 |