Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) |
Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (8 PDB entries) Coagulation factor XIII, |
Domain d1f13a2: 1f13 A:516-627 [22163] Other proteins in same PDB: d1f13a1, d1f13a4, d1f13b1, d1f13b4 |
PDB Entry: 1f13 (more details), 2.1 Å
SCOPe Domain Sequences for d1f13a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f13a2 b.1.5.1 (A:516-627) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]} snvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkketfdv tleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl
Timeline for d1f13a2:
View in 3D Domains from other chains: (mouse over for more information) d1f13b1, d1f13b2, d1f13b3, d1f13b4 |