Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Isoamylase, N-terminal domain N [49226] (1 species) elaborated with a few large insertions in the common fold precedes the catalytic (beta/alpha)8-barrel domain, the domain architecture similar to maltogenic amylases |
Species Pseudomonas amyloderamosa [TaxId:32043] [49227] (1 PDB entry) |
Domain d1bf2a1: 1bf2 A:1-162 [21860] Other proteins in same PDB: d1bf2a2, d1bf2a3 complexed with ca |
PDB Entry: 1bf2 (more details), 2 Å
SCOPe Domain Sequences for d1bf2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bf2a1 b.1.18.2 (A:1-162) Isoamylase, N-terminal domain N {Pseudomonas amyloderamosa [TaxId: 32043]} ainsmslgasydaqqanitfrvyssqatrivlylysagygvqesatytlspagsgvwavt vpvssikaagitgavyygyrawgpnwpyasnwgkgsqagfvsdvdangdrfnpnkllldp yaqevsqdplnpsnqngnvfasgasyrttdsgiyapkgvvlv
Timeline for d1bf2a1: