SCOPe 2.08: Domain d1bf2a1: 1bf2 A:1-162

Lineage for d1bf2a1 (1bf2 A:1-162)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Isoamylase, N-terminal domain N [49226] (1 species)
   elaborated with a few large insertions in the common fold
   precedes the catalytic (beta/alpha)8-barrel domain, the domain architecture similar to maltogenic amylases

7. Species Pseudomonas amyloderamosa [TaxId:32043] [49227] (1 PDB entry)

8. Domain d1bf2a1: 1bf2 A:1-162 [21860]
   Other proteins in same PDB: d1bf2a2, d1bf2a3
   complexed with ca
   has additional subdomain(s) that are not in the common domain

Details for d1bf2a1

PDB Entry: 1bf2, 2 Å

PDB Description: structure of pseudomonas isoamylase

PDB Compounds: (A:) isoamylase

SCOPe Domain Sequences for d1bf2a1:

Sequence; same for both SEQRES and ATOM records:

>d1bf2a1 b.1.18.2 (A:1-162) Isoamylase, N-terminal domain N {Pseudomonas amyloderamosa [TaxId: 32043]}
ainsmslgasydaqqanitfrvyssqatrivlylysagygvqesatytlspagsgvwavt
vpvssikaagitgavyygyrawgpnwpyasnwgkgsqagfvsdvdangdrfnpnkllldp
yaqevsqdplnpsnqngnvfasgasyrttdsgiyapkgvvlv

Timeline for d1bf2a1:

• d1bf2a1 first appeared (with stable ids) in SCOP 1.55, called d1bf2_1
  
• d1bf2a1 appears in SCOPe 2.07