Lineage for d1bf2_1 (1bf2 1-162)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9697Protein Isoamylase, N-terminal domain [49226] (1 species)
  7. 9698Species Pseudomonas amyloderamosa [TaxId:32043] [49227] (1 PDB entry)
  8. 9699Domain d1bf2_1: 1bf2 1-162 [21860]
    Other proteins in same PDB: d1bf2_2, d1bf2_3

Details for d1bf2_1

PDB Entry: 1bf2 (more details), 2 Å

PDB Description: structure of pseudomonas isoamylase

SCOP Domain Sequences for d1bf2_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf2_1 b.1.1.5 (1-162) Isoamylase, N-terminal domain {Pseudomonas amyloderamosa}
ainsmslgasydaqqanitfrvyssqatrivlylysagygvqesatytlspagsgvwavt
vpvssikaagitgavyygyrawgpnwpyasnwgkgsqagfvsdvdangdrfnpnkllldp
yaqevsqdplnpsnqngnvfasgasyrttdsgiyapkgvvlv

SCOP Domain Coordinates for d1bf2_1:

Click to download the PDB-style file with coordinates for d1bf2_1.
(The format of our PDB-style files is described here.)

Timeline for d1bf2_1: