SCOPe 2.08: Domain d3v4zb2: 3v4z B:97-306

Lineage for d3v4zb2 (3v4z B:97-306)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (39 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [226277] (1 PDB entry)

8. Domain d3v4zb2: 3v4z B:97-306 [217666]
   Other proteins in same PDB: d3v4za1, d3v4zb1
   automated match to d1iova2
   complexed with peg, pge

Details for d3v4zb2

PDB Entry: 3v4z, 2.69 Å

PDB Description: d-alanine--d-alanine ligase from yersinia pestis

PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3v4zb2:

Sequence, based on SEQRES records:

>d3v4zb2 d.142.1.0 (B:97-306) automated matches {Yersinia pestis [TaxId: 214092]}
klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshegssvgmsk
vdhaselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvfydydaky
lsdktqyfcpsglsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspg
mtshslvpmaarqyglsfsqlvarilmlad

Sequence, based on observed residues (ATOM records):

>d3v4zb2 d.142.1.0 (B:97-306) automated matches {Yersinia pestis [TaxId: 214092]}
klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshgmskvdhas
elqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqpptqyfcpsglsdeseq
qlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspgmtshslvpmaarqyglsfs
qlvarilmlad

Timeline for d3v4zb2:

• d3v4zb2 first appeared in SCOPe 2.03
  
• d3v4zb2 appears in SCOPe 2.07