PDB entry 3v4z

View 3v4z on RCSB PDB site
Description: D-alanine--D-alanine ligase from Yersinia pestis
Class: ligase
Keywords: structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, peptidoglycan synthesis, LIGASE
Deposited on 2011-12-15, released 2011-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanine--d-alanine ligase
    Species: Yersinia pestis [TaxId:214092]
    Gene: ddl, ddlB, y3624, YPO0557, YP_3627
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v4za1, d3v4za2
  • Chain 'B':
    Compound: d-alanine--d-alanine ligase
    Species: Yersinia pestis [TaxId:214092]
    Gene: ddl, ddlB, y3624, YPO0557, YP_3627
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3v4zb1, d3v4zb2
  • Heterogens: PEG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3v4zA (A:)
    snamaekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdk
    vfialhgrggedgtlqgvleflqlpytgsgvmasaltmdklrtklvwqalglpispyval
    nrqqfetlspeelvacvaklglplivkpshegssvgmskvdhaselqkalveafqhdsdv
    liekwlsgpeftvailgdevlpsiriqppgvfydydakylsdktqyfcpsglsdeseqql
    aalalqayhaldcsgwgrvdvmqdrdghfyllevntspgmtshslvpmaarqyglsfsql
    varilmlad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v4zA (A:)
    aekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfia
    lhgrggedgtlqgvleflqlpytgsgvmasaltmdklrtklvwqalglpispyvalnrqq
    fetlspeelvacvaklglplivkpshegssvgmskvdhaselqkalveafqhdsdvliek
    wlsgpeftvailgdevlpsiriqppgktqyfcpsglsdeseqqlaalalqayhaldcsgw
    grvdvmqdrdghfyllevntspgmtshslvpmaarqyglsfsqlvarilmlad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3v4zB (B:)
    snamaekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdk
    vfialhgrggedgtlqgvleflqlpytgsgvmasaltmdklrtklvwqalglpispyval
    nrqqfetlspeelvacvaklglplivkpshegssvgmskvdhaselqkalveafqhdsdv
    liekwlsgpeftvailgdevlpsiriqppgvfydydakylsdktqyfcpsglsdeseqql
    aalalqayhaldcsgwgrvdvmqdrdghfyllevntspgmtshslvpmaarqyglsfsql
    varilmlad
    

    Sequence, based on observed residues (ATOM records): (download)
    >3v4zB (B:)
    maekvavllggtsaerevsllsgqavlaglkeagidaygvdtkdfpvtqlkeqgfdkvfi
    alhgrggedgtlqgvleflqlpytgsgvmasaltmdklrtklvwqalglpispyvalnrq
    qfetlspeelvacvaklglplivkpshgmskvdhaselqkalveafqhdsdvliekwlsg
    peftvailgdevlpsiriqpptqyfcpsglsdeseqqlaalalqayhaldcsgwgrvdvm
    qdrdghfyllevntspgmtshslvpmaarqyglsfsqlvarilmlad