SCOPe 2.08: Domain d3s4ya2: 3s4y A:159-242

Lineage for d3s4ya2 (3s4y A:159-242)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.6: Thiamin pyrophosphokinase, substrate-binding domain [63862] (1 family)

5. Family b.82.6.1: Thiamin pyrophosphokinase, substrate-binding domain [63863] (1 protein)

6. Protein Thiamin pyrophosphokinase, substrate-binding domain [63864] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [226155] (1 PDB entry)

8. Domain d3s4ya2: 3s4y A:159-242 [216208]
   Other proteins in same PDB: d3s4ya1, d3s4yb1
   automated match to d1ig3a1
   complexed with ca, so4, tpp, unx

Details for d3s4ya2

PDB Entry: 3s4y, 1.8 Å

PDB Description: crystal structure of human thiamin pyrophosphokinase 1

PDB Compounds: (A:) Thiamin pyrophosphokinase 1

SCOPe Domain Sequences for d3s4ya2:

Sequence, based on SEQRES records:

>d3s4ya2 b.82.6.1 (A:159-242) Thiamin pyrophosphokinase, substrate-binding domain {Human (Homo sapiens) [TaxId: 9606]}
esliyllqpgkhrlhvdtgmegdwcglipvgqpcmqvtttglkwnltndvlafgtlvsts
ntydgsgvvtvetdhpllwtmaik

Sequence, based on observed residues (ATOM records):

>d3s4ya2 b.82.6.1 (A:159-242) Thiamin pyrophosphokinase, substrate-binding domain {Human (Homo sapiens) [TaxId: 9606]}
esliyllqpgkhrlhvmegdwcglipvgqpcmqvtttglkwnltndvlafgtlvstsnty
dgsgvvtvetdhpllwtmaik

Timeline for d3s4ya2:

• d3s4ya2 first appeared in SCOPe 2.03
  
• d3s4ya2 appears in SCOPe 2.07