Lineage for d3s4yb1 (3s4y B:16-158)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919028Fold c.100: Thiamin pyrophosphokinase, catalytic domain [63998] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 432156
  4. 2919029Superfamily c.100.1: Thiamin pyrophosphokinase, catalytic domain [63999] (1 family) (S)
  5. 2919030Family c.100.1.1: Thiamin pyrophosphokinase, catalytic domain [64000] (1 protein)
  6. 2919031Protein Thiamin pyrophosphokinase, catalytic domain [64001] (3 species)
  7. 2919035Species Human (Homo sapiens) [TaxId:9606] [226154] (1 PDB entry)
  8. 2919037Domain d3s4yb1: 3s4y B:16-158 [216209]
    Other proteins in same PDB: d3s4ya2, d3s4yb2
    automated match to d1ig3a2
    complexed with ca, so4, tpp, unx

Details for d3s4yb1

PDB Entry: 3s4y (more details), 1.8 Å

PDB Description: crystal structure of human thiamin pyrophosphokinase 1
PDB Compounds: (B:) Thiamin pyrophosphokinase 1

SCOPe Domain Sequences for d3s4yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s4yb1 c.100.1.1 (B:16-158) Thiamin pyrophosphokinase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
nlkyclvilnqpldnyfrhlwnkallracadgganrlyditegeresflpefingdfdsi
rpevreyyatkgcelistpdqdhtdftkclkmlqkkieekdlkvdvivtlgglagrfdqi
masvntlfqathitpfpiiiiqe

SCOPe Domain Coordinates for d3s4yb1:

Click to download the PDB-style file with coordinates for d3s4yb1.
(The format of our PDB-style files is described here.)

Timeline for d3s4yb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3s4yb2