Lineage for d1sebf1 (1seb F:93-192)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8374Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species)
  7. 8378Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (5 PDB entries)
  8. 8398Domain d1sebf1: 1seb F:93-192 [21604]
    Other proteins in same PDB: d1seba2, d1sebb2, d1sebd1, d1sebd2, d1sebe2, d1sebf2, d1sebh1, d1sebh2

Details for d1sebf1

PDB Entry: 1seb (more details), 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb

SCOP Domain Sequences for d1sebf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sebf1 b.1.1.2 (F:93-192) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewrars

SCOP Domain Coordinates for d1sebf1:

Click to download the PDB-style file with coordinates for d1sebf1.
(The format of our PDB-style files is described here.)

Timeline for d1sebf1: