Lineage for d1sebh1 (1seb H:2-121)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13929Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 13940Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 13941Species Staphylococcus aureus [TaxId:1280] [50227] (10 PDB entries)
  8. 13953Domain d1sebh1: 1seb H:2-121 [25195]
    Other proteins in same PDB: d1seba1, d1seba2, d1sebb1, d1sebb2, d1sebd2, d1sebe1, d1sebe2, d1sebf1, d1sebf2, d1sebh2

Details for d1sebh1

PDB Entry: 1seb (more details), 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb
PDB Compounds: (H:)

SCOP Domain Sequences for d1sebh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sebh1 b.40.2.2 (H:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtydnvr
vefknkdladkykdkyvdvfganyyyqcyfskkktcmyggvteh

SCOP Domain Coordinates for d1sebh1:

Click to download the PDB-style file with coordinates for d1sebh1.
(The format of our PDB-style files is described here.)

Timeline for d1sebh1: