![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species) |
![]() | Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (5 PDB entries) |
![]() | Domain d1seba1: 1seb A:82-181 [21601] Other proteins in same PDB: d1seba2, d1sebb2, d1sebd1, d1sebd2, d1sebe2, d1sebf2, d1sebh1, d1sebh2 |
PDB Entry: 1seb (more details), 2.7 Å
SCOP Domain Sequences for d1seba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1seba1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1} itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d1seba1: