Lineage for d1nfdb2 (1nfd B:118-247)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 290095Protein T-cell antigen receptor [49125] (6 species)
  7. 290139Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (10 PDB entries)
  8. 290152Domain d1nfdb2: 1nfd B:118-247 [21567]
    Other proteins in same PDB: d1nfda1, d1nfdb1, d1nfdc1, d1nfdd1, d1nfde1, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh1, d1nfdh2

Details for d1nfdb2

PDB Entry: 1nfd (more details), 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

SCOP Domain Sequences for d1nfdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfdb2 b.1.1.2 (B:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc

SCOP Domain Coordinates for d1nfdb2:

Click to download the PDB-style file with coordinates for d1nfdb2.
(The format of our PDB-style files is described here.)

Timeline for d1nfdb2: