SCOP 1.65: Domain d1nfdg1: 1nfd G:2-107

Lineage for d1nfdg1 (1nfd G:2-107)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (8 species)
VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

Species Hamster (Cricetulus griseus) [TaxId:10029] [88542] (1 PDB entry)

Domain d1nfdg1: 1nfd G:2-107 [20188]
Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg2, d1nfdh1, d1nfdh2
part of Fab H57
complexed with nag

Details for d1nfdg1

PDB Entry: 1nfd (more details), 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

SCOP Domain Sequences for d1nfdg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfdg1 b.1.1.1 (G:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus)}
yeliqpssasvtvgetvkitcsgdqlpknfaywfqqksdknillliymdnkrpsgiperf
sgstsgttatltisgaqpedeaayyclssygdnndlvfgsgtqltvlr

SCOP Domain Coordinates for d1nfdg1:

Click to download the PDB-style file with coordinates for d1nfdg1.
(The format of our PDB-style files is described here.)

Timeline for d1nfdg1: