SCOP 1.59: Domain d2hmid2: 2hmi D:124-220

Lineage for d2hmid2 (2hmi D:124-220)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Fab 28 against HIV-1 RT (mouse), kappa L chain [49068] (3 PDB entries)

8. Domain d2hmid2: 2hmi D:124-220 [21275]
   Other proteins in same PDB: d2hmia1, d2hmia2, d2hmib1, d2hmic1, d2hmid1

Details for d2hmid2

PDB Entry: 2hmi, 2.8 Å

PDB Description: hiv-1 reverse transcriptase/fragment of fab 28/dna complex

SCOP Domain Sequences for d2hmid2:

Sequence; same for both SEQRES and ATOM records:

>d2hmid2 b.1.1.2 (D:124-220) Immunoglobulin (constant domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
aattppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkki

Timeline for d2hmid2:

• d2hmid2 first appeared (with stable ids) in SCOP 1.55
  
• d2hmid2 appears in SCOP 1.57
  
• d2hmid2 appears in SCOP 1.61
  
• d2hmid2 appears in the current release, SCOPe 2.08