Lineage for d2hmic2 (2hmi C:108-214)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 103949Species Fab 28 against HIV-1 RT (mouse), kappa L chain [49068] (3 PDB entries)
  8. 103950Domain d2hmic2: 2hmi C:108-214 [21274]
    Other proteins in same PDB: d2hmia1, d2hmia2, d2hmib1, d2hmic1, d2hmid1

Details for d2hmic2

PDB Entry: 2hmi (more details), 2.8 Å

PDB Description: hiv-1 reverse transcriptase/fragment of fab 28/dna complex

SCOP Domain Sequences for d2hmic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmic2 b.1.1.2 (C:108-214) Immunoglobulin (constant domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvawaidgsaaangvlnswtdqd
skdstysmsstltltadeyeaansytcaathktstspivksfnanec

SCOP Domain Coordinates for d2hmic2:

Click to download the PDB-style file with coordinates for d2hmic2.
(The format of our PDB-style files is described here.)

Timeline for d2hmic2: