Lineage for d2hmib1 (2hmi B:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 140913Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 140914Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
  5. 140971Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 140972Protein HIV-1 reverse transcriptase [56689] (1 species)
  7. 140973Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (56 PDB entries)
  8. 141070Domain d2hmib1: 2hmi B: [43107]
    Other proteins in same PDB: d2hmia1, d2hmic1, d2hmic2, d2hmid1, d2hmid2

Details for d2hmib1

PDB Entry: 2hmi (more details), 2.8 Å

PDB Description: hiv-1 reverse transcriptase/fragment of fab 28/dna complex

SCOP Domain Sequences for d2hmib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmib1 e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyqle

SCOP Domain Coordinates for d2hmib1:

Click to download the PDB-style file with coordinates for d2hmib1.
(The format of our PDB-style files is described here.)

Timeline for d2hmib1: