SCOPe 2.05: Domain d1adqh2: 1adq H:114-223B

Lineage for d1adqh2 (1adq H:114-223B)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries)

8. Domain d1adqh2: 1adq H:114-223B [21273]
   Other proteins in same PDB: d1adqa1, d1adqa2, d1adqh1, d1adql1, d1adql2
   part of IgM rheumatoid factor Fab

Details for d1adqh2

PDB Entry: 1adq, 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc

PDB Compounds: (H:) igm-lambda rf-an fab (heavy chain)

SCOPe Domain Sequences for d1adqh2:

Sequence; same for both SEQRES and ATOM records:

>d1adqh2 b.1.1.2 (H:114-223B) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvmqgtnehvvckvqhpngnkekdvpl

Timeline for d1adqh2:

• d1adqh2 first appeared (with stable ids) in SCOP 1.55
  
• d1adqh2 appears in SCOPe 2.04
  
• d1adqh2 appears in SCOPe 2.06
  
• d1adqh2 appears in the current release, SCOPe 2.08