Lineage for d1adql1 (1adq L:2-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757501Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 1757579Species Human (Homo sapiens), cluster 5 [TaxId:9606] [88540] (7 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 1757589Domain d1adql1: 1adq L:2-107 [20272]
    Other proteins in same PDB: d1adqa1, d1adqa2, d1adqh1, d1adqh2, d1adql2
    part of IgM rheumatoid factor Fab

Details for d1adql1

PDB Entry: 1adq (more details), 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc
PDB Compounds: (L:) igm-lambda rf-an fab (light chain)

SCOPe Domain Sequences for d1adql1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adql1 b.1.1.1 (L:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]}
yvltqppsvsvapgqtaritcggnnigsksvhwyqqkpgqapvlvvyddsdrppgiperf
sgsnsgntatltisrveagdeadyycqvwdsssdhavfgggtkltvlg

SCOPe Domain Coordinates for d1adql1:

Click to download the PDB-style file with coordinates for d1adql1.
(The format of our PDB-style files is described here.)

Timeline for d1adql1: