Lineage for d1adqh2 (1adq H:114-223B)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9193Species IgM rheumatoid factor Fab (human), lambda L chain [49067] (1 PDB entry)
  8. 9194Domain d1adqh2: 1adq H:114-223B [21273]
    Other proteins in same PDB: d1adqh1, d1adql1

Details for d1adqh2

PDB Entry: 1adq (more details), 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc

SCOP Domain Sequences for d1adqh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adqh2 b.1.1.2 (H:114-223B) Immunoglobulin (constant domains of L and H chains) {IgM rheumatoid factor Fab (human), lambda L chain}
gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvmqgtnehvvckvqhpngnkekdvpl

SCOP Domain Coordinates for d1adqh2:

Click to download the PDB-style file with coordinates for d1adqh2.
(The format of our PDB-style files is described here.)

Timeline for d1adqh2: