![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
![]() | Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [88573] (1 PDB entry) |
![]() | Domain d1nfdg2: 1nfd G:108-215 [21204] Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde1, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdh1, d1nfdh2 part of Fab H57 complexed with nag, ndg |
PDB Entry: 1nfd (more details), 2.8 Å
SCOPe Domain Sequences for d1nfdg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfdg2 b.1.1.2 (G:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} gpksspkvtvfppspeelrtnkatlvclvndfypgsatvtwkangatindgvkttkpskq gqnymtssylsltadqwkshnrvscqvthegetvekslspaecl
Timeline for d1nfdg2: