Lineage for d1nfda1 (1nfd A:1-117)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1105447Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1105548Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (21 PDB entries)
  8. 1105579Domain d1nfda1: 1nfd A:1-117 [20612]
    Other proteins in same PDB: d1nfda2, d1nfdb2, d1nfdc2, d1nfdd2, d1nfde1, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh1, d1nfdh2
    complexed with nag, ndg

Details for d1nfda1

PDB Entry: 1nfd (more details), 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
PDB Compounds: (A:) n15 alpha-beta T-cell receptor

SCOPe Domain Sequences for d1nfda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfda1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
dsvtqteglvtvteglpvklnctyqttyltiaffwyvqylneapqvllksstdnkrtehq
gfhatlhkssssfhlqkssaqlsdsalyycalseggnykyvfgagtrlkviah

SCOPe Domain Coordinates for d1nfda1:

Click to download the PDB-style file with coordinates for d1nfda1.
(The format of our PDB-style files is described here.)

Timeline for d1nfda1: