Lineage for d1nfdg2 (1nfd G:108-215)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8965Species Fab H57 (hamster), lambda L chain [49050] (1 PDB entry)
  8. 8968Domain d1nfdg2: 1nfd G:108-215 [21204]
    Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde1, d1nfdf1, d1nfdg1, d1nfdh1

Details for d1nfdg2

PDB Entry: 1nfd (more details), 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

SCOP Domain Sequences for d1nfdg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfdg2 b.1.1.2 (G:108-215) Immunoglobulin (constant domains of L and H chains) {Fab H57 (hamster), lambda L chain}
gpksspkvtvfppspeelrtnkatlvclvndfypgsatvtwkangatindgvkttkpskq
gqnymtssylsltadqwkshnrvscqvthegetvekslspaecl

SCOP Domain Coordinates for d1nfdg2:

Click to download the PDB-style file with coordinates for d1nfdg2.
(The format of our PDB-style files is described here.)

Timeline for d1nfdg2: