Lineage for d1nfdf1 (1nfd F:1-114)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7693Species Fab H57 (hamster), lambda L chain [48836] (1 PDB entry)
  8. 7695Domain d1nfdf1: 1nfd F:1-114 [20187]
    Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde2, d1nfdf2, d1nfdg2, d1nfdh2

Details for d1nfdf1

PDB Entry: 1nfd (more details), 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

SCOP Domain Sequences for d1nfdf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfdf1 b.1.1.1 (F:1-114) Immunoglobulin (variable domains of L and H chains) {Fab H57 (hamster), lambda L chain}
evylvesggdlvqpgsslkvscaasgftfsdfwmywvrqapgkglewvgriknipnnyat
eyadsvrgrftisrddsrnsiylqmnrlrvddtaiyyctragrfdhfdywgqgtmvtvss
a

SCOP Domain Coordinates for d1nfdf1:

Click to download the PDB-style file with coordinates for d1nfdf1.
(The format of our PDB-style files is described here.)

Timeline for d1nfdf1: