Class b: All beta proteins [48724] (177 folds) |
Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily) barrel, closed; n=7, S=10; complex topology |
Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) |
Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein) this domain interrupts beta/alpha-barrel domain C-terminal domain is alpha/beta |
Protein Pyruvate kinase (PK) [50802] (6 species) |
Species Trypanosome (Leishmania mexicana) [TaxId:5665] [50805] (11 PDB entries) |
Domain d3is4b2: 3is4 B:88-186 [211867] Other proteins in same PDB: d3is4a1, d3is4a3, d3is4b1, d3is4b3 automated match to d1pkla1 complexed with gol, ptk |
PDB Entry: 3is4 (more details), 2.1 Å
SCOPe Domain Sequences for d3is4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3is4b2 b.58.1.1 (B:88-186) Pyruvate kinase (PK) {Trypanosome (Leishmania mexicana) [TaxId: 5665]} eirtgqfvggdavmergatcyvttdpafadkgtkdkfyidyqnlskvvrpgnyiyiddgi lilqvqshedeqtlectvtnshtisdrrgvnlpgcdvdl
Timeline for d3is4b2: