SCOP 1.61: Domain d1yuhh2: 1yuh H:119-218

Lineage for d1yuhh2 (1yuh H:119-218)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab anti-nitrophenol (mouse/human), lambda L chain [49030] (1 PDB entry)

8. Domain d1yuhh2: 1yuh H:119-218 [21129]
   Other proteins in same PDB: d1yuha1, d1yuhb1, d1yuhh1, d1yuhl1

Details for d1yuhh2

PDB Entry: 1yuh, 3 Å

PDB Description: fab fragment

SCOP Domain Sequences for d1yuhh2:

Sequence; same for both SEQRES and ATOM records:

>d1yuhh2 b.1.1.2 (H:119-218) Immunoglobulin (constant domains of L and H chains) {Fab anti-nitrophenol (mouse/human), lambda L chain}
aattppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsd
lytlsssvtvpastwpsgtvtcnvahpasstavdkkivpr

Timeline for d1yuhh2:

• d1yuhh2 first appeared (with stable ids) in SCOP 1.55
  
• d1yuhh2 appears in SCOP 1.59
  
• d1yuhh2 appears in SCOP 1.63
  
• d1yuhh2 appears in the current release, SCOPe 2.08