Lineage for d1yuha2 (1yuh A:110-212)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159697Species Fab anti-nitrophenol (mouse/human), lambda L chain [49030] (1 PDB entry)
  8. 159698Domain d1yuha2: 1yuh A:110-212 [21130]
    Other proteins in same PDB: d1yuha1, d1yuhb1, d1yuhh1, d1yuhl1

Details for d1yuha2

PDB Entry: 1yuh (more details), 3 Å

PDB Description: fab fragment

SCOP Domain Sequences for d1yuha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuha2 b.1.1.2 (A:110-212) Immunoglobulin (constant domains of L and H chains) {Fab anti-nitrophenol (mouse/human), lambda L chain}
gqpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtegmettqpsk
qsnnkymassyltlsarawerhasyscqvtheghtvekslsra

SCOP Domain Coordinates for d1yuha2:

Click to download the PDB-style file with coordinates for d1yuha2.
(The format of our PDB-style files is described here.)

Timeline for d1yuha2: