Lineage for d1yuhh2 (1yuh H:119-218)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8821Species Fab anti-nitrophenol (mouse/human), lambda L chain [49030] (1 PDB entry)
  8. 8824Domain d1yuhh2: 1yuh H:119-218 [21129]
    Other proteins in same PDB: d1yuha1, d1yuhb1, d1yuhh1, d1yuhl1

Details for d1yuhh2

PDB Entry: 1yuh (more details), 3 Å

PDB Description: fab fragment

SCOP Domain Sequences for d1yuhh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuhh2 b.1.1.2 (H:119-218) Immunoglobulin (constant domains of L and H chains) {Fab anti-nitrophenol (mouse/human), lambda L chain}
aattppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsd
lytlsssvtvpastwpsgtvtcnvahpasstavdkkivpr

SCOP Domain Coordinates for d1yuhh2:

Click to download the PDB-style file with coordinates for d1yuhh2.
(The format of our PDB-style files is described here.)

Timeline for d1yuhh2: