Lineage for d1plgl2 (1plg L:113-215)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 54138Species Polysialic acid-binding Fab (mouse), kappa L chain [49026] (1 PDB entry)
  8. 54140Domain d1plgl2: 1plg L:113-215 [21112]
    Other proteins in same PDB: d1plgh1, d1plgl1

Details for d1plgl2

PDB Entry: 1plg (more details), 2.8 Å

PDB Description: evidence for the extended helical nature of polysaccharide epitopes. the 2.8 angstroms resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2->8)-polysialic acid

SCOP Domain Sequences for d1plgl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1plgl2 b.1.1.2 (L:113-215) Immunoglobulin (constant domains of L and H chains) {Polysialic acid-binding Fab (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

SCOP Domain Coordinates for d1plgl2:

Click to download the PDB-style file with coordinates for d1plgl2.
(The format of our PDB-style files is described here.)

Timeline for d1plgl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1plgl1