SCOP 1.57: Domain d1plgh1: 1plg H:1-117

Lineage for d1plgh1 (1plg H:1-117)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Polysialic acid-binding Fab (mouse), kappa L chain [48809] (1 PDB entry)

8. Domain d1plgh1: 1plg H:1-117 [20081]
   Other proteins in same PDB: d1plgh2, d1plgl2

Details for d1plgh1

PDB Entry: 1plg, 2.8 Å

PDB Description: evidence for the extended helical nature of polysaccharide epitopes. the 2.8 angstroms resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2->8)-polysialic acid

SCOP Domain Sequences for d1plgh1:

Sequence; same for both SEQRES and ATOM records:

>d1plgh1 b.1.1.1 (H:1-117) Immunoglobulin (variable domains of L and H chains) {Polysialic acid-binding Fab (mouse), kappa L chain}
qiqlqqsgpelvrpgasvkisckasgytftdyyihwvkqrpgeglewigwiypgsgntky
nekfkgkatltvdtssstaymqlssltsedsavyfcarggkfamdywgqgtsvtvss

Timeline for d1plgh1:

• d1plgh1 first appeared (with stable ids) in SCOP 1.55
  
• d1plgh1 appears in SCOP 1.59
  
• d1plgh1 appears in the current release, SCOPe 2.08