SCOP 1.55: Domain d1plgl2: 1plg L:113-215

Lineage for d1plgl2 (1plg L:113-215)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Polysialic acid-binding Fab (mouse), kappa L chain [49026] (1 PDB entry)

8. Domain d1plgl2: 1plg L:113-215 [21112]
   Other proteins in same PDB: d1plgh1, d1plgl1

Details for d1plgl2

PDB Entry: 1plg, 2.8 Å

PDB Description: evidence for the extended helical nature of polysaccharide epitopes. the 2.8 angstroms resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2->8)-polysialic acid

SCOP Domain Sequences for d1plgl2:

Sequence; same for both SEQRES and ATOM records:

>d1plgl2 b.1.1.2 (L:113-215) Immunoglobulin (constant domains of L and H chains) {Polysialic acid-binding Fab (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

Timeline for d1plgl2:

• d1plgl2 appears in SCOP 1.57
  
• d1plgl2 appears in the current release, SCOPe 2.08