Lineage for d3gqta2 (3gqt A:243-394)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708527Species Burkholderia pseudomallei [TaxId:320372] [225463] (6 PDB entries)
  8. 2708532Domain d3gqta2: 3gqt A:243-394 [210633]
    Other proteins in same PDB: d3gqta1, d3gqtb1, d3gqtc1, d3gqtd1
    automated match to d1siqa1
    complexed with ufo

Details for d3gqta2

PDB Entry: 3gqt (more details), 1.99 Å

PDB Description: Crystal structure of glutaryl-CoA dehydrogenase from Burkholderia pseudomallei with fragment (1,4-dimethyl-1,2,3,4-tetrahydroquinoxalin-6-yl)methylamine
PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3gqta2:

Sequence, based on SEQRES records: (download)

>d3gqta2 a.29.3.0 (A:243-394) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
lrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqte
itlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvar
hlvnlevvntyegthdihalilgraqtgiqaf

Sequence, based on observed residues (ATOM records): (download)

>d3gqta2 a.29.3.0 (A:243-394) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
lrgpftclnsarygiawgalgaaescwhiarqyvldrkqfgrplaanqliqkkladmqte
itlglqgvlrlgrmkdegtaaveitsimkrnscgkaldiarlardmlggngisdefgvar
hlvnlevvntyhdihalilgraqtgiqaf

SCOPe Domain Coordinates for d3gqta2:

Click to download the PDB-style file with coordinates for d3gqta2.
(The format of our PDB-style files is described here.)

Timeline for d3gqta2: