Lineage for d3gqtd1 (3gqt D:4-242)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570412Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2570413Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2570558Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2570559Protein automated matches [226934] (28 species)
    not a true protein
  7. 2570604Species Burkholderia pseudomallei [TaxId:320372] [225462] (6 PDB entries)
  8. 2570612Domain d3gqtd1: 3gqt D:4-242 [210638]
    Other proteins in same PDB: d3gqta2, d3gqtb2, d3gqtc2, d3gqtd2
    automated match to d1siqa2
    complexed with ufo

Details for d3gqtd1

PDB Entry: 3gqt (more details), 1.99 Å

PDB Description: Crystal structure of glutaryl-CoA dehydrogenase from Burkholderia pseudomallei with fragment (1,4-dimethyl-1,2,3,4-tetrahydroquinoxalin-6-yl)methylamine
PDB Compounds: (D:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3gqtd1:

Sequence, based on SEQRES records: (download)

>d3gqtd1 e.6.1.0 (D:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfvvwa
kldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

Sequence, based on observed residues (ATOM records): (download)

>d3gqtd1 e.6.1.0 (D:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepmvtrarkvpggyslsgskmwitnspiadvfvvwaklddeirg
filekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

SCOPe Domain Coordinates for d3gqtd1:

Click to download the PDB-style file with coordinates for d3gqtd1.
(The format of our PDB-style files is described here.)

Timeline for d3gqtd1: