Lineage for d3fq3b_ (3fq3 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790901Family b.40.5.0: automated matches [191399] (1 protein)
    not a true family
  6. 2790902Protein automated matches [190523] (12 species)
    not a true protein
  7. 2790913Species Brucella melitensis [TaxId:359391] [225590] (1 PDB entry)
  8. 2790915Domain d3fq3b_: 3fq3 B: [210045]
    automated match to d3sw5f_
    complexed with po4

Details for d3fq3b_

PDB Entry: 3fq3 (more details), 1.9 Å

PDB Description: Crystal structure of inorganic phosphatase from brucella melitensis
PDB Compounds: (B:) Inorganic pyrophosphatase:Bacterial/Archaeal inorganic pyrophosphatase

SCOPe Domain Sequences for d3fq3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fq3b_ b.40.5.0 (B:) automated matches {Brucella melitensis [TaxId: 359391]}
mnidaisigsnppedvnviievpvggqpikyemdkkagalivdrflytpmtypgnygfvp
htlsedgdpidvlvcntrplipgcvinvrpigvlvmednsgkdekiiavpsphltrryek
ihdytdmpeitlkqiahffehykdlepgkwvkigdwgdedyarkfiveaierak

SCOPe Domain Coordinates for d3fq3b_:

Click to download the PDB-style file with coordinates for d3fq3b_.
(The format of our PDB-style files is described here.)

Timeline for d3fq3b_: