Lineage for d3dx9a1 (3dx9 A:2-125)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742896Domain d3dx9a1: 3dx9 A:2-125 [209344]
    Other proteins in same PDB: d3dx9a2, d3dx9b1, d3dx9b2, d3dx9c2, d3dx9d1, d3dx9d2
    automated match to d2esvd1

Details for d3dx9a1

PDB Entry: 3dx9 (more details), 2.75 Å

PDB Description: Crystal Structure of the DM1 TCR at 2.75A
PDB Compounds: (A:) DM1 T cell receptor alpha chain

SCOPe Domain Sequences for d3dx9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dx9a1 b.1.1.1 (A:2-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akttqptsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
liitedrksstlilphatlrdtavyycivwggyqkvtfgtgtklqvip

SCOPe Domain Coordinates for d3dx9a1:

Click to download the PDB-style file with coordinates for d3dx9a1.
(The format of our PDB-style files is described here.)

Timeline for d3dx9a1: