Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (5 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88601] (6 PDB entries) |
Domain d3frud_: 3fru D: [20660] Other proteins in same PDB: d3frua1, d3frua2, d3fruc1, d3fruc2, d3frue1, d3frue2 complexed with bme, nag, so4 |
PDB Entry: 3fru (more details), 2.2 Å
SCOPe Domain Sequences for d3frud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3frud_ b.1.1.2 (D:) beta2-microglobulin {Norway rat (Rattus norvegicus) [TaxId: 10116]} iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
Timeline for d3frud_: