Lineage for d2vpra2 (2vpr A:68-205)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2728262Family a.121.1.0: automated matches [227226] (1 protein)
    not a true family
  6. 2728263Protein automated matches [226967] (6 species)
    not a true protein
  7. 2728280Species Pasteurella multocida [TaxId:747] [225421] (1 PDB entry)
  8. 2728281Domain d2vpra2: 2vpr A:68-205 [206412]
    Other proteins in same PDB: d2vpra1
    automated match to d1qpia2
    protein/DNA complex; complexed with mg, so4, tdc

Details for d2vpra2

PDB Entry: 2vpr (more details), 2.49 Å

PDB Description: tet repressor class h in complex with 5a,6- anhydrotetracycline-mg
PDB Compounds: (A:) tetracycline resistance repressor protein

SCOPe Domain Sequences for d2vpra2:

Sequence, based on SEQRES records: (download)

>d2vpra2 a.121.1.0 (A:68-205) automated matches {Pasteurella multocida [TaxId: 747]}
lplpnetwqdflrnnaksfrqallmyrdggkihagtrpsesqfetseqqlqflcdagfsl
sqavyalssiahftlgsvletqehqesqkerekvetdtvaypplltqavaimdsdngdaa
flfvldvmisgletvlksak

Sequence, based on observed residues (ATOM records): (download)

>d2vpra2 a.121.1.0 (A:68-205) automated matches {Pasteurella multocida [TaxId: 747]}
lplpnetwqdflrnnaksfrqallmyrdggkihagtrpsesqfetseqqlqflcdagfsl
sqavyalssiahftlgsvletqehqesqkeaypplltqavaimdsdngdaaflfvldvmi
sgletvlksak

SCOPe Domain Coordinates for d2vpra2:

Click to download the PDB-style file with coordinates for d2vpra2.
(The format of our PDB-style files is described here.)

Timeline for d2vpra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vpra1