PDB entry 2vpr

View 2vpr on RCSB PDB site
Description: Tet repressor class H in complex with 5a,6- anhydrotetracycline-Mg
Class: transcription
Keywords: transcription, metal-binding, antibiotic resistance, transcription regulator, transcription regulation DNA-binding
Deposited on 2008-03-03, released 2008-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline resistance repressor protein
    Species: PASTEURELLA MULTOCIDA [TaxId:747]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2vpra1, d2vpra2
  • Heterogens: TDC, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vprA (A:)
    makldkeqvidnalillnevgieglttrklaqkigveqptlywhvknkralldalaetil
    qkhhhhvlplpnetwqdflrnnaksfrqallmyrdggkihagtrpsesqfetseqqlqfl
    cdagfslsqavyalssiahftlgsvletqehqesqkerekvetdtvaypplltqavaimd
    sdngdaaflfvldvmisgletvlksak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vprA (A:)
    akldkeqvidnalillnevgieglttrklaqkigveqptlywhvknkralldalaetilq
    khhhhvlplpnetwqdflrnnaksfrqallmyrdggkihagtrpsesqfetseqqlqflc
    dagfslsqavyalssiahftlgsvletqehqesqkeaypplltqavaimdsdngdaaflf
    vldvmisgletvlksak