SCOP 1.65: Domain d1ivla_: 1ivl A:

Lineage for d1ivla_ (1ivl A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (25 PDB entries)

8. Domain d1ivla_: 1ivl A: [20516]

Details for d1ivla_

PDB Entry: 1ivl, 2.17 Å

PDB Description: the de novo design of an antibody combining site: crystallographic analysis of the vl domain confirms the structural model

SCOP Domain Sequences for d1ivla_:

Sequence; same for both SEQRES and ATOM records:

>d1ivla_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
dieltqspatlsvtpgnsvsiscrasqsignrlfwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedlavyfcqqvsewpftfgggtkleik

Timeline for d1ivla_:

• d1ivla_ first appeared (with stable ids) in SCOP 1.55
  
• d1ivla_ appears in SCOP 1.63
  
• d1ivla_ appears in SCOP 1.67
  
• d1ivla_ appears in the current release, SCOPe 2.08