SCOP 1.63: Domain d1ivla_: 1ivl A:

Lineage for d1ivla_ (1ivl A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species VL domain (kappa) of antibody M29B, dimer synthetic [48919] (1 PDB entry)

8. Domain d1ivla_: 1ivl A: [20516]

Details for d1ivla_

PDB Entry: 1ivl, 2.17 Å

PDB Description: the de novo design of an antibody combining site: crystallographic analysis of the vl domain confirms the structural model

SCOP Domain Sequences for d1ivla_:

Sequence; same for both SEQRES and ATOM records:

>d1ivla_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {VL domain (kappa) of antibody M29B, dimer synthetic}
dieltqspatlsvtpgnsvsiscrasqsignrlfwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedlavyfcqqvsewpftfgggtkleik

Timeline for d1ivla_:

• d1ivla_ first appeared (with stable ids) in SCOP 1.55
  
• d1ivla_ appears in SCOP 1.61
  
• d1ivla_ appears in SCOP 1.65
  
• d1ivla_ appears in the current release, SCOPe 2.08