Lineage for d1etza1 (1etz A:1-110)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) 
Species Anti-sweetener Fab NC10.14, (mouse), lamba L chain [48904] (1 PDB entry) 
Domain d1etza1: 1etz A:1-110 [20480]
Other proteins in same PDB: d1etza2, d1etzb2, d1etzh2, d1etzl2
Details for d1etza1
PDB Entry: 1etz (more details), 2.6 Å
PDB Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins
SCOP Domain Sequences for d1etza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1etza1 b.1.1.1 (A:1-110) Immunoglobulin (variable domains of L and H chains) {Anti-sweetener Fab NC10.14, (mouse), lamba L chain}
favvtqesalttspgetvtltcrsstgavttsnyaiwvqekpdhlfsgliggtnnrvpgv
parfsgsligdkaaltvtgaqtedeaiyfcalwysnhwvfgggtkltvlg
SCOP Domain Coordinates for d1etza1:
Click to download the PDB-style file with coordinates for d1etza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1etza1:
View in 3D
