Lineage for d1etzl2 (1etz L:111-215)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53363Species Anti-sweetener Fab NC10.14, (mouse), lamba L chain [49108] (1 PDB entry)
  8. 53367Domain d1etzl2: 1etz L:111-215 [21442]
    Other proteins in same PDB: d1etza1, d1etzb1, d1etzh1, d1etzl1

Details for d1etzl2

PDB Entry: 1etz (more details), 2.6 Å

PDB Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins

SCOP Domain Sequences for d1etzl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etzl2 b.1.1.2 (L:111-215) Immunoglobulin (constant domains of L and H chains) {Anti-sweetener Fab NC10.14, (mouse), lamba L chain}
qpksspsvtlftpsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtvekslsraecs

SCOP Domain Coordinates for d1etzl2:

Click to download the PDB-style file with coordinates for d1etzl2.
(The format of our PDB-style files is described here.)

Timeline for d1etzl2: