Lineage for d1etzh1 (1etz H:1-126)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51828Species Anti-sweetener Fab NC10.14, (mouse), lamba L chain [48904] (1 PDB entry)
  8. 51831Domain d1etzh1: 1etz H:1-126 [20479]
    Other proteins in same PDB: d1etza2, d1etzb2, d1etzh2, d1etzl2

Details for d1etzh1

PDB Entry: 1etz (more details), 2.6 Å

PDB Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins

SCOP Domain Sequences for d1etzh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etzh1 b.1.1.1 (H:1-126) Immunoglobulin (variable domains of L and H chains) {Anti-sweetener Fab NC10.14, (mouse), lamba L chain}
qvtlkesgpgilqpsqtlsltcsfsgfslstsgmgvgwirqpsgeglewladiwwndkky
ynpslksrltvskdtssnqvflkitsvdtsdtatyhcarrtfsyyygssfyyfdnwgqgt
tltvss

SCOP Domain Coordinates for d1etzh1:

Click to download the PDB-style file with coordinates for d1etzh1.
(The format of our PDB-style files is described here.)

Timeline for d1etzh1: