Lineage for d2gbcb2 (2gbc B:510-767)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902577Species Norway rat (Rattus norvegicus) [TaxId:10116] [188292] (9 PDB entries)
  8. 2902585Domain d2gbcb2: 2gbc B:510-767 [204332]
    Other proteins in same PDB: d2gbca1, d2gbcb1
    automated match to d1orva2
    complexed with nag

Details for d2gbcb2

PDB Entry: 2gbc (more details), 2.8 Å

PDB Description: native dpp-iv (cd26) from rat
PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2gbcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbcb2 c.69.1.0 (B:510-767) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpskkldfivlnetrfwyqmilpphfdkskkypllidvyagpcsqkadaafrlnwatyla
steniivasfdgrgsgyqgdkimhainkrlgtlevedqieaarqflkmgfvdskrvaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdagvdfqamwytdedhgiasstah
qhiyshmshflqqcfslr

SCOPe Domain Coordinates for d2gbcb2:

Click to download the PDB-style file with coordinates for d2gbcb2.
(The format of our PDB-style files is described here.)

Timeline for d2gbcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gbcb1