SCOPe 2.05: Domain d1zzhd2: 1zzh D:170-326

Lineage for d1zzhd2 (1zzh D:170-326)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (18 species)
   not a true protein

7. Species Rhodobacter capsulatus [TaxId:1061] [225039] (1 PDB entry)

8. Domain d1zzhd2: 1zzh D:170-326 [203379]
   automated match to d1nmla2
   complexed with ca, hec, zn

Details for d1zzhd2

PDB Entry: 1zzh, 2.7 Å

PDB Description: Structure of the fully oxidized di-heme cytochrome c peroxidase from R. capsulatus

PDB Compounds: (D:) cytochrome c peroxidase

SCOPe Domain Sequences for d1zzhd2:

Sequence, based on SEQRES records:

>d1zzhd2 a.3.1.0 (D:170-326) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
nskfdqwlmgadgamsadekaglklfidtgcaachnginiggngyypfgvvekpgaevlp
agdkgrfavtataddeyvfragplrnialtapyfhsgkvwdlreavsvmansqlgatldd
tqvdqitaflgtltgeqpevvhpilpvrsaqtprpeh

Sequence, based on observed residues (ATOM records):

>d1zzhd2 a.3.1.0 (D:170-326) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
nskfdqwlmgadgamsadekaglklfidtgcaachnginiggngyypfgvvekpgrfavt
ataddeyvfragplrnialtapyfhsgkvwdlreavsvmansqlgatlddtqvdqitafl
gtltgeqpevvhpilpvrsaqtprpeh

Timeline for d1zzhd2:

• d1zzhd2 first appeared in SCOPe 2.03
  
• d1zzhd2 appears in SCOPe 2.04
  
• d1zzhd2 appears in SCOPe 2.06
  
• d1zzhd2 appears in the current release, SCOPe 2.08