Lineage for d1zzhd2 (1zzh D:170-326)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476826Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1476827Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1477453Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1477454Protein automated matches [190453] (16 species)
    not a true protein
  7. 1477532Species Rhodobacter capsulatus [TaxId:1061] [225039] (1 PDB entry)
  8. 1477540Domain d1zzhd2: 1zzh D:170-326 [203379]
    automated match to d1nmla2
    complexed with ca, hec, zn

Details for d1zzhd2

PDB Entry: 1zzh (more details), 2.7 Å

PDB Description: Structure of the fully oxidized di-heme cytochrome c peroxidase from R. capsulatus
PDB Compounds: (D:) cytochrome c peroxidase

SCOPe Domain Sequences for d1zzhd2:

Sequence, based on SEQRES records: (download)

>d1zzhd2 a.3.1.0 (D:170-326) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
nskfdqwlmgadgamsadekaglklfidtgcaachnginiggngyypfgvvekpgaevlp
agdkgrfavtataddeyvfragplrnialtapyfhsgkvwdlreavsvmansqlgatldd
tqvdqitaflgtltgeqpevvhpilpvrsaqtprpeh

Sequence, based on observed residues (ATOM records): (download)

>d1zzhd2 a.3.1.0 (D:170-326) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
nskfdqwlmgadgamsadekaglklfidtgcaachnginiggngyypfgvvekpgrfavt
ataddeyvfragplrnialtapyfhsgkvwdlreavsvmansqlgatlddtqvdqitafl
gtltgeqpevvhpilpvrsaqtprpeh

SCOPe Domain Coordinates for d1zzhd2:

Click to download the PDB-style file with coordinates for d1zzhd2.
(The format of our PDB-style files is described here.)

Timeline for d1zzhd2: