Class a: All alpha proteins [46456] (285 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
Protein automated matches [190453] (16 species) not a true protein |
Species Rhodobacter capsulatus [TaxId:1061] [225039] (1 PDB entry) |
Domain d1zzhd2: 1zzh D:170-326 [203379] automated match to d1nmla2 complexed with ca, hec, zn |
PDB Entry: 1zzh (more details), 2.7 Å
SCOPe Domain Sequences for d1zzhd2:
Sequence, based on SEQRES records: (download)
>d1zzhd2 a.3.1.0 (D:170-326) automated matches {Rhodobacter capsulatus [TaxId: 1061]} nskfdqwlmgadgamsadekaglklfidtgcaachnginiggngyypfgvvekpgaevlp agdkgrfavtataddeyvfragplrnialtapyfhsgkvwdlreavsvmansqlgatldd tqvdqitaflgtltgeqpevvhpilpvrsaqtprpeh
>d1zzhd2 a.3.1.0 (D:170-326) automated matches {Rhodobacter capsulatus [TaxId: 1061]} nskfdqwlmgadgamsadekaglklfidtgcaachnginiggngyypfgvvekpgrfavt ataddeyvfragplrnialtapyfhsgkvwdlreavsvmansqlgatlddtqvdqitafl gtltgeqpevvhpilpvrsaqtprpeh
Timeline for d1zzhd2: